Antibody
Rabbit Anti Glucagon Like Peptide 2 (GLP2) Antibody
Product Description
“The product is affinity purified and specifically recognizes the Human Glucagon Like Peptide 2 (GLP2). The antibody can be used for variety of application.The antibody is a rabbit polyclonal antibody raised against Glucagon Like Peptide 2 (GLP2). It has been selected for its ability to recognize GLP2 ptor in immunohistochemical staining and western blotting. It is recommended that the end user optimizes the product
for their particular application with appropriate controls.”
| Catalouge No. | AB3087-100 |
|---|---|
| Pack Size : | 100 µg and 500 µg |
| Immunogen | Synthetic Peptide, GLP2 conjugated to OVA.Target peptide sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR |
| Reactivity | Human |
| Host Species | Rabbit |
| Clonality | Polyclonal |
| Form | Liquid |
| Formulation Buffer | 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol. |
| Preservative | 0.05% Proclin-300 |
| Specificity | Glucagon Like Peptide 2 (GLP2) |
| Application | WB, IHC, ICC, IP |
| Storage | Shipped at 2-8°C. Aliqote and Storet at-20°C; Avoid repeated freeze/thaw cycles. |
| Regulatory | For research use only (RUO) |